ST3GAL3 antibody (N-Term)
-
- Target See all ST3GAL3 Antibodies
- ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST3GAL3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ST3 GAL3 antibody was raised against the N terminal of ST3 AL3
- Purification
- Affinity purified
- Immunogen
- ST3 GAL3 antibody was raised using the N terminal of ST3 AL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK
- Top Product
- Discover our top product ST3GAL3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST3GAL3 Blocking Peptide, catalog no. 33R-6531, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))
- Alternative Name
- ST3GAL3 (ST3GAL3 Products)
- Background
- ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.
- Molecular Weight
- 42 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-