ST3GAL3 antibody (N-Term)

Catalog No. ABIN635965

Product Details anti-ST3GAL3 Antibody

Target: ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST3GAL3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ST3 GAL3 antibody was raised against the N terminal of ST3 AL3

Purification: Affinity purified

Immunogen: ST3 GAL3 antibody was raised using the N terminal of ST3 AL3 corresponding to a region with amino acids MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST3GAL3 Blocking Peptide, catalog no. 33R-6531, is also available for use as a blocking control in assays to test for specificity of this ST3GAL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST3GAL3

Target: ST3GAL3 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 3 (ST3GAL3))

Alternative Name: ST3GAL3 (ST3GAL3 Products)

Synonyms: siat6 antibody, st3Gal-III antibody, st3galii antibody, st3galiii antibody, st3n antibody, SIAT6 antibody, EIEE15 antibody, MRT12 antibody, ST3GALII antibody, ST3GalIII antibody, ST3N antibody, ST3GAL-III antibody, Siat3 antibody, Siat6 antibody, ST3GALIII antibody, st3gal3 antibody, zgc:63978 antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 3 S homeolog antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 3 antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 3a antibody, st3gal3.S antibody, ST3GAL3 antibody, St3gal3 antibody, st3gal3a antibody

Background: ST3GAL3 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST3GAL3 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process