ST3GAL4 antibody (Middle Region)
-
- Target See all ST3GAL4 Antibodies
- ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ST3GAL4 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ST3 GAL4 antibody was raised against the middle region of ST3 AL4
- Purification
- Affinity purified
- Immunogen
- ST3 GAL4 antibody was raised using the middle region of ST3 AL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV
- Top Product
- Discover our top product ST3GAL4 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ST3GAL4 Blocking Peptide, catalog no. 33R-2869, is also available for use as a blocking control in assays to test for specificity of this ST3GAL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))
- Alternative Name
- ST3GAL4 (ST3GAL4 Products)
- Background
- Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase, ST6GAL1.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-