ST3GAL4 antibody (Middle Region)

Catalog No. ABIN635964

Product Details anti-ST3GAL4 Antibody

Target: ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST3GAL4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: ST3 GAL4 antibody was raised against the middle region of ST3 AL4

Purification: Affinity purified

Immunogen: ST3 GAL4 antibody was raised using the middle region of ST3 AL4 corresponding to a region with amino acids FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST3GAL4 Blocking Peptide, catalog no. 33R-2869, is also available for use as a blocking control in assays to test for specificity of this ST3GAL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST3GAL4

Target: ST3GAL4 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 4 (ST3GAL4))

Alternative Name: ST3GAL4 (ST3GAL4 Products)

Synonyms: siat4c antibody, im:7151092 antibody, zgc:158162 antibody, SIAT4C antibody, CGS23 antibody, NANTA3 antibody, SAT3 antibody, SIAT4 antibody, ST3GalIV antibody, STZ antibody, ST3GAL-IV antibody, Siat4c antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 4 antibody, ST3 beta-galactoside alpha-2,3-sialyltransferase 4 L homeolog antibody, st3gal4 antibody, ST3GAL4 antibody, St3gal4 antibody, st3gal4.L antibody

Background: Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase, ST6GAL1.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process