HAS3 antibody (C-Term)

Catalog No. ABIN635963

Product Details anti-HAS3 Antibody

Target: HAS3 (Hyaluronan Synthase 3 (HAS3))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAS3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HAS3 antibody was raised against the C terminal of HAS3

Purification: Affinity purified

Immunogen: HAS3 antibody was raised using the C terminal of HAS3 corresponding to a region with amino acids SDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAS3 Blocking Peptide, catalog no. 33R-8377, is also available for use as a blocking control in assays to test for specificity of this HAS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HAS3

Target: HAS3 (Hyaluronan Synthase 3 (HAS3))

Alternative Name: HAS3 (HAS3 Products)

Synonyms: HAS3 antibody, dg42III antibody, xx:af190743gs1 antibody, xx:af190743gs2 antibody, xhas3 antibody, CHAS3 antibody, hyaluronan synthase 3 antibody, hyaluronan synthase 3 S homeolog antibody, HAS3 antibody, has3 antibody, Has3 antibody, has3.S antibody

Background: HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process