HAS3 antibody (N-Term)
-
- Target See all HAS3 Antibodies
- HAS3 (Hyaluronan Synthase 3 (HAS3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HAS3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HAS3 antibody was raised against the N terminal of HAS3
- Purification
- Affinity purified
- Immunogen
- HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD
- Top Product
- Discover our top product HAS3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HAS3 Blocking Peptide, catalog no. 33R-3489, is also available for use as a blocking control in assays to test for specificity of this HAS3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAS3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAS3 (Hyaluronan Synthase 3 (HAS3))
- Alternative Name
- HAS3 (HAS3 Products)
- Synonyms
- HAS3 antibody, dg42III antibody, xx:af190743gs1 antibody, xx:af190743gs2 antibody, xhas3 antibody, CHAS3 antibody, hyaluronan synthase 3 antibody, hyaluronan synthase 3 S homeolog antibody, HAS3 antibody, has3 antibody, Has3 antibody, has3.S antibody
- Background
- HAS3 is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-