TMPRSS11D antibody (Middle Region)

Catalog No. ABIN635959

Product Details anti-TMPRSS11D Antibody

Target: TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMPRSS11D antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMPRSS11 D antibody was raised against the middle region of TMPRSS11

Purification: Affinity purified

Immunogen: TMPRSS11 D antibody was raised using the middle region of TMPRSS11 corresponding to a region with amino acids IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMPRSS11D Blocking Peptide, catalog no. 33R-3987, is also available for use as a blocking control in assays to test for specificity of this TMPRSS11D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMPRSS11D

Target: TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))

Alternative Name: TMPRSS11D (TMPRSS11D Products)

Synonyms: HAT antibody, AST antibody, AsP antibody, BC020151 antibody, Asp antibody, Tmprss11d antibody, transmembrane protease, serine 11D antibody, transmembrane protease, serine 11d antibody, transmembrane protease serine 11D antibody, TMPRSS11D antibody, Tmprss11d antibody, LOC100720850 antibody

Background: TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Regulation of Carbohydrate Metabolic Process