Oncostatin M Receptor antibody (N-Term)

Catalog No. ABIN635957

Product Details anti-Oncostatin M Receptor Antibody

Target: Oncostatin M Receptor (OSMR)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Oncostatin M Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OSMR antibody was raised against the N terminal of OSMR

Purification: Affinity purified

Immunogen: OSMR antibody was raised using the N terminal of OSMR corresponding to a region with amino acids YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OSMR Blocking Peptide, catalog no. 33R-10217, is also available for use as a blocking control in assays to test for specificity of this OSMR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSMR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Oncostatin M Receptor

Target: Oncostatin M Receptor (OSMR)

Alternative Name: OSMR (OSMR Products)

Synonyms: OSMRB antibody, PLCA1 antibody, oncostatin M receptor antibody, OSMR antibody, Osmr antibody

Background: Oncostatin M is a member of the IL6 family of cytokines. Functional receptors for IL6 family cytokines are multisubunit complexes involving members of the hematopoietin receptor superfamily. Many IL6 cytokines utilize gp130 as a common receptor subunit. OSM binds to the gp130 receptor subunit and, in association with the leukemia inhibitory factor receptor, induces a proliferative response in permissive cells.

Molecular Weight: 110 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Growth Factor Binding