B4GALNT1 antibody (N-Term)

Catalog No. ABIN635951

Product Details anti-B4GALNT1 Antibody

Target: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B4GALNT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: B4 GALNT1 antibody was raised against the N terminal of B4 ALNT1

Purification: Affinity purified

Immunogen: B4 GALNT1 antibody was raised using the N terminal of B4 ALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B4GALNT1 Blocking Peptide, catalog no. 33R-1441, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B4GALNT1

Target: B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))

Alternative Name: B4GALNT1 (B4GALNT1 Products)

Synonyms: MGC53523 antibody, B4GALNT1 antibody, zgc:158609 antibody, GALGT antibody, GALNACT antibody, GalNAc-T antibody, SPG26 antibody, 4933429D13Rik antibody, Gal-NAc-T antibody, GalNAcT antibody, Galgt1 antibody, Ggm-2 antibody, Ggm2 antibody, beta-1,4-N-acetyl-galactosaminyl transferase 1 L homeolog antibody, beta-1,4-N-acetyl-galactosaminyl transferase 1a antibody, beta-1,4-N-acetyl-galactosaminyl transferase 1 antibody, Beta-1,4 N-acetylgalactosaminyltransferase 1 antibody, beta-1,4-N-acetyl-galactosaminyltransferase 1 antibody, b4galnt1.L antibody, b4galnt1a antibody, b4galnt1 antibody, b4gn1 antibody, B4GALNT1 antibody, B4galnt1 antibody

Background: GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids.

Molecular Weight: 59 kDa (MW of target protein)