B4GALNT1 antibody (N-Term)
-
- Target See all B4GALNT1 Antibodies
- B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B4GALNT1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B4 GALNT1 antibody was raised against the N terminal of B4 ALNT1
- Purification
- Affinity purified
- Immunogen
- B4 GALNT1 antibody was raised using the N terminal of B4 ALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG
- Top Product
- Discover our top product B4GALNT1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B4GALNT1 Blocking Peptide, catalog no. 33R-1441, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B4GALNT1 (beta-1,4-N-Acetyl-Galactosaminyl Transferase 1 (B4GALNT1))
- Alternative Name
- B4GALNT1 (B4GALNT1 Products)
- Background
- GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids.
- Molecular Weight
- 59 kDa (MW of target protein)
-