Tyrosinase-Related Protein 1 antibody (Middle Region)

Catalog No. ABIN635947

Product Details anti-Tyrosinase-Related Protein 1 Antibody

Target: Tyrosinase-Related Protein 1 (TYRP1)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tyrosinase-Related Protein 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TYRP1 antibody was raised against the middle region of TYRP1

Purification: Affinity purified

Immunogen: TYRP1 antibody was raised using the middle region of TYRP1 corresponding to a region with amino acids NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TYRP1 Blocking Peptide, catalog no. 33R-6659, is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYRP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tyrosinase-Related Protein 1

Target: Tyrosinase-Related Protein 1 (TYRP1)

Alternative Name: TYRP1 (TYRP1 Products)

Synonyms: CAS2 antibody, CATB antibody, GP75 antibody, OCA3 antibody, TRP antibody, TRP1 antibody, TYRP antibody, b-PROTEIN antibody, LOC397853 antibody, Trypsin antibody, hm:zeh0659 antibody, tyrp1 antibody, zgc:100893 antibody, B antibody, TYRP1 antibody, tyrp-1 antibody, TRP-1 antibody, Tyrp antibody, b antibody, brown antibody, isa antibody, tyrosinase related protein 1 antibody, protease, serine 1 L homeolog antibody, tyrosinase-related protein 1b antibody, tyrosinase-related protein 1 antibody, tyrosinase-related protein 1 L homeolog antibody, tyrosinase-related protein 1a antibody, TYRP1 antibody, prss1.L antibody, tyrp1b antibody, Tyrp1 antibody, tyrp1.L antibody, tyrp1 antibody, LOC100136490 antibody, tyrp-1 antibody, tyrp1a antibody

Background: TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.

Molecular Weight: 61 kDa (MW of target protein)