ERMAP antibody

Catalog No. ABIN635933

Product Details anti-ERMAP Antibody

Target: ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERMAP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERMAP Blocking Peptide, catalog no. 33R-6968, is also available for use as a blocking control in assays to test for specificity of this ERMAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERMAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERMAP

Target: ERMAP (erythroblast Membrane-Associated Protein (Scianna Blood Group) (ERMAP))

Alternative Name: ERMAP (ERMAP Products)

Synonyms: AA409279 antibody, AI666418 antibody, PRO2801 antibody, RD antibody, SC antibody, erythroblast membrane associated protein (Scianna blood group) antibody, erythroblast membrane-associated protein antibody, ERMAP antibody, Ermap antibody

Background: The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene.

Molecular Weight: 52 kDa (MW of target protein)