UGCG antibody (N-Term)

Catalog No. ABIN635932

Product Details anti-UGCG Antibody

Target: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGCG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGCG antibody was raised against the N terminal of µgCG

Purification: Affinity purified

Immunogen: UGCG antibody was raised using the N terminal of µgCG corresponding to a region with amino acids LHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGCG Blocking Peptide, catalog no. 33R-5018, is also available for use as a blocking control in assays to test for specificity of this µgCG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGCG

Target: UGCG (UDP-Glucose Ceramide Glucosyltransferase (UGCG))

Alternative Name: UGCG (UGCG Products)

Synonyms: GCS antibody, GLCT1 antibody, XLCGT antibody, gcs antibody, glct1 antibody, ugcga antibody, xlcgt antibody, cb539 antibody, sb:cb539 antibody, zgc:112506 antibody, ugcg antibody, ugcgb antibody, AU043821 antibody, C80537 antibody, Epcs21 antibody, GlcT-1 antibody, Ugcgl antibody, UDP-glucose ceramide glucosyltransferase antibody, UDP-glucose ceramide glucosyltransferase L homeolog antibody, UDP-glucose ceramide glucosyltransferase S homeolog antibody, UGCG antibody, ugcg.L antibody, Ugcg antibody, ugcg antibody, ugcg.S antibody

Background: Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes.

Molecular Weight: 45 kDa (MW of target protein)