C12orf49 antibody (C-Term)

Catalog No. ABIN635928

Product Details anti-C12orf49 Antibody

Target: C12orf49 (Chromosome 12 Open Reading Frame 49 (C12orf49))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C12orf49 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C12 ORF49 antibody was raised against the C terminal Of C12 rf49

Purification: Affinity purified

Immunogen: C12 ORF49 antibody was raised using the C terminal Of C12 rf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C12ORF49 Blocking Peptide, catalog no. 33R-4924, is also available for use as a blocking control in assays to test for specificity of this C12ORF49 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C12orf49

Target: C12orf49 (Chromosome 12 Open Reading Frame 49 (C12orf49))

Alternative Name: C12ORF49 (C12orf49 Products)

Synonyms: C12orf49 antibody, chromosome 12 open reading frame 49 antibody, chromosome 17 open reading frame, human C12orf49 antibody, chromosome 15 C12orf49 homolog antibody, chromosome 12 open reading frame 49 S homeolog antibody, RIKEN cDNA 2410131K14 gene antibody, zgc:110063 antibody, C12orf49 antibody, C17H12orf49 antibody, C15H12orf49 antibody, c12orf49.S antibody, c12orf49 antibody, 2410131K14Rik antibody, zgc:110063 antibody

Background: The function of C12orf49 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 23 kDa (MW of target protein)