DNAJB11 antibody

Catalog No. ABIN635926

Product Details anti-DNAJB11 Antibody

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJB11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DNAJB11 antibody was raised using a synthetic peptide corresponding to a region with amino acids FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJB11 Blocking Peptide, catalog no. 33R-2868, is also available for use as a blocking control in assays to test for specificity of this DNAJB11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJB11

Target: DNAJB11 (DnaJ (Hsp40) Homolog, Subfamily B, Member 11 (DNAJB11))

Alternative Name: DNAJB11 (DNAJB11 Products)

Synonyms: MGC75796 antibody, MGC81924 antibody, ABBP-2 antibody, ABBP2 antibody, DJ9 antibody, Dj-9 antibody, EDJ antibody, ERdj3 antibody, ERj3 antibody, ERj3p antibody, PRO1080 antibody, UNQ537 antibody, hDj-9 antibody, 1810031F23Rik antibody, AL024055 antibody, Dj9 antibody, LRRGT00084 antibody, cb954 antibody, DnaJ heat shock protein family (Hsp40) member B11 antibody, DnaJ heat shock protein family (Hsp40) member B11 S homeolog antibody, DnaJ (Hsp40) homolog, subfamily B, member 11 antibody, dnajb11 antibody, DNAJB11 antibody, dnajb11.S antibody, Dnajb11 antibody

Background: DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a C-terminal cysteine-rich region.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling