SLC8A3 antibody

Catalog No. ABIN635923

Product Details anti-SLC8A3 Antibody

Target: SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC8A3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SLC8 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC8A3 Blocking Peptide, catalog no. 33R-8309, is also available for use as a blocking control in assays to test for specificity of this SLC8A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC8A3

Target: SLC8A3 (Solute Carrier Family 8 (Sodium/calcium Exchanger), Member 3 (SLC8A3))

Alternative Name: SLC8A3 (SLC8A3 Products)

Synonyms: SLC8A3 antibody, NCX3 antibody, Ncx3 antibody, AW742262 antibody, solute carrier family 8 member A3 antibody, solute carrier family 8 (sodium/calcium exchanger), member 3 antibody, SLC8A3 antibody, slc8a3 antibody, Slc8a3 antibody

Background: SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.

Molecular Weight: 103 kDa (MW of target protein)