MTTP antibody (N-Term)
-
- Target See all MTTP Antibodies
- MTTP (Microsomal Triglyceride Transfer Protein (MTTP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTTP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MTTP antibody was raised against the N terminal of MTTP
- Purification
- Affinity purified
- Immunogen
- MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
- Top Product
- Discover our top product MTTP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTTP Blocking Peptide, catalog no. 33R-6112, is also available for use as a blocking control in assays to test for specificity of this MTTP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTTP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTTP (Microsomal Triglyceride Transfer Protein (MTTP))
- Alternative Name
- MTTP (MTTP Products)
- Background
- MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.
- Molecular Weight
- 97 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-