PQLC1 antibody (Middle Region)
-
- Target See all PQLC1 Antibodies
- PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PQLC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PQLC1 antibody was raised against the middle region of PQLC1
- Purification
- Affinity purified
- Immunogen
- PQLC1 antibody was raised using the middle region of PQLC1 corresponding to a region with amino acids TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW
- Top Product
- Discover our top product PQLC1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PQLC1 Blocking Peptide, catalog no. 33R-9395, is also available for use as a blocking control in assays to test for specificity of this PQLC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PQLC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PQLC1 (PQ Loop Repeat Containing 1 (PQLC1))
- Alternative Name
- PQLC1 (PQLC1 Products)
- Synonyms
- 2310009N05Rik antibody, 4933425L21Rik antibody, 5730564E11Rik antibody, C78974 antibody, pqlc1 antibody, PQ loop repeat containing 1 antibody, PQ loop repeat containing 1, gene 1 L homeolog antibody, PQLC1 antibody, Pqlc1 antibody, pqlc1.1.L antibody
- Background
- PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown.
- Molecular Weight
- 30 kDa (MW of target protein)
-