TMEM123 antibody (C-Term)
-
- Target See all TMEM123 Antibodies
- TMEM123 (Transmembrane Protein 123 (TMEM123))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM123 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM123 antibody was raised against the C terminal of TMEM123
- Purification
- Affinity purified
- Immunogen
- TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG
- Top Product
- Discover our top product TMEM123 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM123 Blocking Peptide, catalog no. 33R-8860, is also available for use as a blocking control in assays to test for specificity of this TMEM123 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM123 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM123 (Transmembrane Protein 123 (TMEM123))
- Alternative Name
- TMEM123 (TMEM123 Products)
- Background
- TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.
- Molecular Weight
- 19 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-