TMEM123 antibody (C-Term)

Catalog No. ABIN635901

Product Details anti-TMEM123 Antibody

Target: TMEM123 (Transmembrane Protein 123 (TMEM123))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM123 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM123 antibody was raised against the C terminal of TMEM123

Purification: Affinity purified

Immunogen: TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM123 Blocking Peptide, catalog no. 33R-8860, is also available for use as a blocking control in assays to test for specificity of this TMEM123 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM123 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM123

Target: TMEM123 (Transmembrane Protein 123 (TMEM123))

Alternative Name: TMEM123 (TMEM123 Products)

Synonyms: KCT3 antibody, PORIMIN antibody, PORMIN antibody, 2310075C12Rik antibody, RGD1305625 antibody, kct3 antibody, pormin antibody, porimin antibody, transmembrane protein 123 antibody, transmembrane protein 123 L homeolog antibody, TMEM123 antibody, Tmem123 antibody, tmem123.L antibody, tmem123 antibody

Background: TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.

Molecular Weight: 19 kDa (MW of target protein)

Pathways: Regulation of Cell Size