RMDN3 antibody (Middle Region)

Catalog No. ABIN635897

Product Details anti-RMDN3 Antibody

Target: RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RMDN3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FAM82 C antibody was raised against the middle region of Fam82

Purification: Affinity purified

Immunogen: FAM82 C antibody was raised using the middle region of Fam82 corresponding to a region with amino acids LSATVEDALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM82C Blocking Peptide, catalog no. 33R-5411, is also available for use as a blocking control in assays to test for specificity of this FAM82C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RMDN3

Target: RMDN3 (FAM82A2) (Family with Sequence Similarity 82, Member A2 (FAM82A2))

Alternative Name: FAM82C (FAM82A2 Products)

Synonyms: FAM82A2 antibody, FAM82C antibody, RMD-3 antibody, RMD3 antibody, ptpip51 antibody, Fam82a2 antibody, Fam82c antibody, Ptpip51 antibody, RGD1308697 antibody, Rmd-3 antibody, 1200015F23Rik antibody, AI131757 antibody, Rmd3 antibody, fam82a2 antibody, fam82c antibody, regulator of microtubule dynamics 3 antibody, regulator of microtubule dynamics 3 L homeolog antibody, RMDN3 antibody, Rmdn3 antibody, rmdn3.L antibody

Background: FAM82C may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82C protein induces apoptosis.

Molecular Weight: 52 kDa (MW of target protein)