EMID1 antibody (C-Term)
-
- Target See all EMID1 products
- EMID1 (EMI Domain Containing 1 (EMID1))
-
Binding Specificity
- C-Term
-
Reactivity
- Rat, Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EMID1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EMID1 antibody was raised against the C terminal of EMID1
- Purification
- Affinity purified
- Immunogen
- EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EMID1 Blocking Peptide, catalog no. 33R-9201, is also available for use as a blocking control in assays to test for specificity of this EMID1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMID1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EMID1 (EMI Domain Containing 1 (EMID1))
- Alternative Name
- EMID1 (EMID1 Products)
- Background
- EMID1 contains 1 collagen-like domain and 1 EMI domain. The exact function of EMID1 remains unknown.
- Molecular Weight
- 45 kDa (MW of target protein)
-