NDST3 antibody

Catalog No. ABIN635893

Product Details anti-NDST3 Antibody

Target: NDST3 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDST3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NDST3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDST3 Blocking Peptide, catalog no. 33R-7135, is also available for use as a blocking control in assays to test for specificity of this NDST3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDST3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDST3

Target: NDST3 (N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3))

Alternative Name: NDST3 (NDST3 Products)

Synonyms: NDST3 antibody, HSST3 antibody, 4921531K01Rik antibody, 4930511P15Rik antibody, N-deacetylase and N-sulfotransferase 3 antibody, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3 antibody, NDST3 antibody, ndst3 antibody, LOC100484094 antibody, LOC100539813 antibody, Ndst3 antibody

Background: NDST3 is a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. NDST3 is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin.

Molecular Weight: 101 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process