LMAN2 antibody (N-Term)

Catalog No. ABIN635887

Product Details anti-LMAN2 Antibody

Target: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LMAN2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: LMAN2 antibody was raised against the N terminal of LMAN2

Purification: Affinity purified

Immunogen: LMAN2 antibody was raised using the N terminal of LMAN2 corresponding to a region with amino acids SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LMAN2 Blocking Peptide, catalog no. 33R-8595, is also available for use as a blocking control in assays to test for specificity of this LMAN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LMAN2

Target: LMAN2 (Lectin, Mannose-Binding 2 (LMAN2))

Alternative Name: LMAN2 (LMAN2 Products)

Synonyms: Lman2 antibody, wu:fb16f04 antibody, zgc:158761 antibody, C5orf8 antibody, GP36B antibody, VIP36 antibody, 1110003H06Rik antibody, 1300009F09Rik antibody, AA408240 antibody, AL023023 antibody, AU040819 antibody, Vip36 antibody, lectin, mannose binding 2 antibody, lectin, mannose-binding 2 antibody, LMAN2 antibody, lman2 antibody, Lman2 antibody

Background: LMAN2 plays a role as an intracellular lectin in the early secretory pathway. It interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. It is involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome