HHAT antibody (N-Term)

Catalog No. ABIN635877

Product Details anti-HHAT Antibody

Target: HHAT (Hedgehog Acyltransferase (HHAT))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HHAT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HHAT antibody was raised against the N terminal of HHAT

Purification: Affinity purified

Immunogen: HHAT antibody was raised using the N terminal of HHAT corresponding to a region with amino acids MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HHAT Blocking Peptide, catalog no. 33R-6202, is also available for use as a blocking control in assays to test for specificity of this HHAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HHAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HHAT

Target: HHAT (Hedgehog Acyltransferase (HHAT))

Alternative Name: HHAT (HHAT Products)

Synonyms: RGD1311746 antibody, MART2 antibody, SKI1 antibody, Skn antibody, 2810432O22Rik antibody, AI462858 antibody, AP-2CRE antibody, Tg(TFAP2A-cre)1Will antibody, hedgehog acyltransferase antibody, Hhat antibody, HHAT antibody, hhat antibody

Background: Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog'.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Hedgehog Signaling