LMF1 antibody (N-Term)
-
- Target See all LMF1 Antibodies
- LMF1 (Lipase Maturation Factor 1 (LMF1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LMF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LMF1 antibody was raised against the N terminal of LMF1
- Purification
- Affinity purified
- Immunogen
- LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFW
- Top Product
- Discover our top product LMF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LMF1 Blocking Peptide, catalog no. 33R-6372, is also available for use as a blocking control in assays to test for specificity of this LMF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LMF1 (Lipase Maturation Factor 1 (LMF1))
- Alternative Name
- LMF1 (LMF1 Products)
- Background
- The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency.
- Molecular Weight
- 65 kDa (MW of target protein)
-