LMF1 antibody (N-Term)

Catalog No. ABIN635873

Product Details anti-LMF1 Antibody

Target: LMF1 (Lipase Maturation Factor 1 (LMF1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LMF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LMF1 antibody was raised against the N terminal of LMF1

Purification: Affinity purified

Immunogen: LMF1 antibody was raised using the N terminal of LMF1 corresponding to a region with amino acids MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LMF1 Blocking Peptide, catalog no. 33R-6372, is also available for use as a blocking control in assays to test for specificity of this LMF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LMF1

Target: LMF1 (Lipase Maturation Factor 1 (LMF1))

Alternative Name: LMF1 (LMF1 Products)

Synonyms: C16orf26 antibody, HMFN1876 antibody, JFP11 antibody, TMEM112 antibody, TMEM112A antibody, 2400010G15Rik antibody, AW822050 antibody, Tmem112 antibody, cld antibody, RGD1310180 antibody, lipase maturation factor 1 antibody, LMF1 antibody, lmf1 antibody, LOC100594835 antibody, Lmf1 antibody

Background: The protein encoded by this gene resides in the endoplasmic reticulum, and is involved in the maturation and transport of lipoprotein lipase through the secretory pathway. Mutations in this gene are associated with combined lipase deficiency.

Molecular Weight: 65 kDa (MW of target protein)