AOC2 antibody

Catalog No. ABIN635871

Product Details anti-AOC2 Antibody

Target: AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AOC2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AOC2 Blocking Peptide (retina specific), catalog no. 33R-7481, is also available for use as a blocking control in assays to test for specificity of this AOC2 antibody (retina specific)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AOC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AOC2

Target: AOC2 (Amine Oxidase, Copper Containing 2 (Retina-Specific) (AOC2))

Alternative Name: AOC2 (AOC2 Products)

Synonyms: DAO2 antibody, RAO antibody, AOC2 antibody, AOC3 antibody, aoc3 antibody, wu:fa94a08 antibody, wu:fe14c05 antibody, zgc:113006 antibody, amine oxidase, copper containing 2 antibody, amine oxidase, copper containing 2 (retina-specific) antibody, membrane primary amine oxidase-like antibody, retina-specific copper amine oxidase antibody, AOC2 antibody, Aoc2 antibody, LOC100353051 antibody, aoc2 antibody

Background: Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.

Molecular Weight: 84 kDa (MW of target protein)