LMAN1 antibody (N-Term)

Catalog No. ABIN635868

Product Details anti-LMAN1 Antibody

Target: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LMAN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LMAN1 antibody was raised against the N terminal of LMAN1

Purification: Affinity purified

Immunogen: LMAN1 antibody was raised using the N terminal of LMAN1 corresponding to a region with amino acids DPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LMAN1 Blocking Peptide, catalog no. 33R-2095, is also available for use as a blocking control in assays to test for specificity of this LMAN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMAN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LMAN1

Target: LMAN1 (Lectin, Mannose-Binding, 1 (LMAN1))

Alternative Name: LMAN1 (LMAN1 Products)

Synonyms: ERGIC-53 antibody, ERGIC53 antibody, F5F8D antibody, FMFD1 antibody, MCFD1 antibody, MR60 antibody, gp58 antibody, 2610020P13Rik antibody, AI326273 antibody, AU043785 antibody, C730041J05 antibody, P58 antibody, p58 antibody, LMAN1 antibody, cpx-iii antibody, cpxiii antibody, lman1 antibody, wu:fc54c09 antibody, wu:fi36e01 antibody, Xp58 antibody, lman1-a antibody, lectin, mannose binding 1 antibody, lectin, mannose-binding, 1 antibody, complexin 3 antibody, lectin, mannose binding 1 S homeolog antibody, LMAN1 antibody, Lman1 antibody, cplx3 antibody, lman1 antibody, lman1.S antibody

Background: LMAN1 is a type I integral membrane protein localized in the intermediate region between the endoplasmic reticulum and the Golgi, presumably recycling between the two compartments. The protein is a mannose-specific lectin and is a member of a novel family of plant lectin homologs in the secretory pathway of animal cells. Mutations in its gene are associated with a coagulation defect. Using positional cloning, its gene was identified as the disease gene leading to combined factor V-factor VIII deficiency, a rare, autosomal recessive disorder in which both coagulation factors V and VIII are diminished.

Molecular Weight: 54 kDa (MW of target protein)