Growth Hormone Receptor antibody (N-Term)
-
- Target See all Growth Hormone Receptor (GHR) Antibodies
- Growth Hormone Receptor (GHR)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Growth Hormone Receptor antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GHR antibody was raised against the N terminal of GHR
- Purification
- Affinity purified
- Immunogen
- GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF
- Top Product
- Discover our top product GHR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GHR Blocking Peptide, catalog no. 33R-5341, is also available for use as a blocking control in assays to test for specificity of this GHR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Growth Hormone Receptor (GHR)
- Alternative Name
- GHR (GHR Products)
- Synonyms
- GHBP antibody, AA986417 antibody, GHR/BP antibody, GHR antibody, ghr antibody, ghr.a antibody, zgc:162141 antibody, growth hormone receptor antibody, growth hormone receptor L homeolog antibody, growth hormone receptor a antibody, GHR antibody, Ghr antibody, ghr.L antibody, ghr antibody, ghra antibody
- Background
- GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, JAK-STAT Signaling, Response to Growth Hormone Stimulus
-