UGT1A1 antibody (N-Term)
-
- Target See all UGT1A1 Antibodies
- UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UGT1A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UGT1 A1 antibody was raised against the N terminal of µgT1 1
- Purification
- Affinity purified
- Immunogen
- UGT1 A1 antibody was raised using the N terminal of µgT1 1 corresponding to a region with amino acids DGSHWLSMLGAIQQLQQRGHEIVVLAPDASLYIRDGAFYTLKTYPVPFQR
- Top Product
- Discover our top product UGT1A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UGT1A1 Blocking Peptide, catalog no. 33R-1966, is also available for use as a blocking control in assays to test for specificity of this µgT1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))
- Alternative Name
- UGT1A1 (UGT1A1 Products)
- Synonyms
- BILIQTL1 antibody, GNT1 antibody, HUG-BR1 antibody, UDPGT antibody, UDPGT 1-1 antibody, UGT1 antibody, UGT1A antibody, Gnt1 antibody, UGT1A01 antibody, Udpgt-1a antibody, UgtBr1 antibody, Udpgt antibody, Ugt1 antibody, zgc:123097 antibody, UDP glucuronosyltransferase family 1 member A1 antibody, UDP glucuronosyltransferase 1 family, polypeptide A1 antibody, UDP-glucuronosyltransferase 1-1 antibody, UDP-glucuronosyltransferase antibody, UDP-glucuronosyltransferase 1-6 antibody, UDP glucuronosyltransferase 1 family polypeptide a1 antibody, UGT1A1 antibody, Ugt1a1 antibody, LOC100065342 antibody, LOC100125517 antibody, LOC100229734 antibody, LOC100405984 antibody, LOC100511479 antibody, ugt1a1 antibody
- Background
- UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha
-