AADAC antibody
-
- Target See all AADAC Antibodies
- AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This AADAC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN
- Top Product
- Discover our top product AADAC Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AADAC Blocking Peptide, catalog no. 33R-1251, is also available for use as a blocking control in assays to test for specificity of this AADAC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))
- Alternative Name
- AADAC (AADAC Products)
- Synonyms
- MGC89272 antibody, AADAC antibody, CES5A1 antibody, DAC antibody, Aada antibody, 5033417E09Rik antibody, AI265437 antibody, arylacetamide deacetylase antibody, arylacetamide deacetylase S homeolog antibody, Arylacetamide deacetylase antibody, arylacetamide deacetylase (esterase) antibody, LOC100056411 antibody, aadac antibody, AADAC antibody, aadac.S antibody, LOC100451808 antibody, ACD3 antibody, PTRG_10278 antibody, aaad antibody, Aadac antibody
- Background
- Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.
- Molecular Weight
- 46 kDa (MW of target protein)
-