SLITRK1 antibody (N-Term)
-
- Target See all SLITRK1 Antibodies
- SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))
-
Binding Specificity
- N-Term
-
Reactivity
- Rat, Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLITRK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLITRK1 antibody was raised against the N terminal of SLITRK1
- Purification
- Affinity purified
- Immunogen
- SLITRK1 antibody was raised using the N terminal of SLITRK1 corresponding to a region with amino acids CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV
- Top Product
- Discover our top product SLITRK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLITRK1 Blocking Peptide, catalog no. 33R-1668, is also available for use as a blocking control in assays to test for specificity of this SLITRK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLITRK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLITRK1 (SLIT and NTRK-Like Family, Member 1 (SLITRK1))
- Alternative Name
- SLITRK1 (SLITRK1 Products)
- Background
- Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.
- Molecular Weight
- 78 kDa (MW of target protein)
-