LRRC15 antibody (N-Term)

Catalog No. ABIN635851

Product Details anti-LRRC15 Antibody

Target: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC15 antibody was raised against the N terminal of LRRC15

Purification: Affinity purified

Immunogen: LRRC15 antibody was raised using the N terminal of LRRC15 corresponding to a region with amino acids LNISALIALRIEKNELSRITPGAFRNLGSLRYLSLANNKLQVLPIGLFQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC15 Blocking Peptide, catalog no. 33R-5224, is also available for use as a blocking control in assays to test for specificity of this LRRC15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC15

Target: LRRC15 (Leucine Rich Repeat Containing 15 (LRRC15))

Alternative Name: LRRC15 (LRRC15 Products)

Synonyms: cb894 antibody, zgc:158286 antibody, LIB antibody, 5430427N11Rik antibody, Lib antibody, leucine rich repeat containing 15 antibody, leucine-rich repeat-containing protein 15 antibody, carboxypeptidase N subunit 2 antibody, LRRC15 antibody, lrrc15 antibody, CpipJ_CPIJ004946 antibody, CpipJ_CPIJ005191 antibody, CpipJ_CPIJ007745 antibody, CPN2 antibody, Lrrc15 antibody

Background: LRRC15 may contribute to regulation of cell-matrix adhesion interactions with respect to astrocyte recruitment around senile plaques in Alzheimer's disease brain. LRRC15 is induced by EWS-WT1(+KTS) in the tumor DSRCT and may play a role in cellular invasion.

Molecular Weight: 64 kDa (MW of target protein)