ST6GALNAC4 antibody (Middle Region)

Catalog No. ABIN635850

Product Details anti-ST6GALNAC4 Antibody

Target: ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST6GALNAC4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ST6 GALNAC4 antibody was raised against the middle region of ST6 ALNAC4

Purification: Affinity purified

Immunogen: ST6 GALNAC4 antibody was raised using the middle region of ST6 ALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST6GALNAC4 Blocking Peptide, catalog no. 33R-7650, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST6GALNAC4

Target: ST6GALNAC4 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 4 (ST6GALNAC4))

Alternative Name: ST6GALNAC4 (ST6GALNAC4 Products)

Synonyms: ST6GALNAC-IV antibody, IV antibody, SIAT3-C antibody, SIAT3C antibody, SIAT7-D antibody, SIAT7D antibody, ST6GALNACIV antibody, ST6GalNAc antibody, SIAT7B antibody, ST6GALNAC2 antibody, st6GalNAc-IV antibody, ST6GalNAcIV antibody, Siat7d antibody, siat7D antibody, ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 antibody, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 antibody, ST6GALNAC4 antibody, St6galnac4 antibody

Background: ST6GALNAC4 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST6GALNAC4 prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. ST6GALNAC4 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. It is a member of glycosyltransferase family 29.

Molecular Weight: 34 kDa (MW of target protein)