TMEM158 antibody (Middle Region)
-
- Target See all TMEM158 Antibodies
- TMEM158 (Transmembrane Protein 158 (TMEM158))
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Rat, Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM158 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM158 antibody was raised against the middle region of TMEM158
- Purification
- Affinity purified
- Immunogen
- TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR
- Top Product
- Discover our top product TMEM158 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM158 Blocking Peptide, catalog no. 33R-1244, is also available for use as a blocking control in assays to test for specificity of this TMEM158 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM158 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM158 (Transmembrane Protein 158 (TMEM158))
- Alternative Name
- TMEM158 (TMEM158 Products)
- Synonyms
- 2310037P21Rik antibody, Ris1 antibody, BBP antibody, RIS1 antibody, p40BBP antibody, transmembrane protein 158 antibody, transmembrane protein 158 (gene/pseudogene) antibody, Tmem158 antibody, TMEM158 antibody
- Background
- TMEM158 is the receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.
- Molecular Weight
- 30 kDa (MW of target protein)
-