FZD7 antibody

Catalog No. ABIN635842

Product Details anti-FZD7 Antibody

Target: FZD7 (Frizzled Family Receptor 7 (FZD7))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FZD7 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: FZD7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FZD7 Blocking Peptide, catalog no. 33R-7010, is also available for use as a blocking control in assays to test for specificity of this FZD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FZD7

Target: FZD7 (Frizzled Family Receptor 7 (FZD7))

Alternative Name: FZD7 (FZD7 Products)

Synonyms: FzE3 antibody, Fz-7 antibody, Xfz7 antibody, frizzled-7 antibody, frizzled7 antibody, frz-7 antibody, frz7 antibody, fz7 antibody, fzd7-a antibody, fzd7-b antibody, fze3 antibody, Fz7 antibody, cFz-7 antibody, fb38g02 antibody, fc44b09 antibody, fz13 antibody, fz7a antibody, fz7b antibody, wu:fb38g02 antibody, wu:fc44b09 antibody, zg13 antibody, frizzled class receptor 7 antibody, frizzled class receptor 7 L homeolog antibody, frizzled class receptor 7b antibody, FZD7 antibody, fzd7.L antibody, fzd7 antibody, Fzd7 antibody, fzd7b antibody

Background: FZD7 is 7-transmembrane domain protein that is receptor for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: WNT Signaling, Stem Cell Maintenance