SYVN1 antibody (C-Term)

Catalog No. ABIN635832

Product Details anti-SYVN1 Antibody

Target: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SYVN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SYVN1 antibody was raised against the C terminal of SYVN1

Purification: Affinity purified

Immunogen: SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SYVN1 Blocking Peptide, catalog no. 33R-1484, is also available for use as a blocking control in assays to test for specificity of this SYVN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYVN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SYVN1

Target: SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))

Alternative Name: SYVN1 (SYVN1 Products)

Synonyms: DER3 antibody, HRD1 antibody, hrd1 antibody, 1200010C09Rik antibody, AW211966 antibody, C85322 antibody, D530017H19Rik antibody, Hrd1 antibody, RGD1310488 antibody, syvn1 antibody, syvn1-a antibody, syvn1-b antibody, wu:fk91f10 antibody, zgc:55735 antibody, zgc:77108 antibody, synoviolin 1 antibody, synovial apoptosis inhibitor 1, synoviolin antibody, synoviolin 1 S homeolog antibody, SYVN1 antibody, syvn1 antibody, Syvn1 antibody, syvn1.S antibody

Background: SYVN1 is a protein involved in endoplasmic reticulum (ER)-associated degradation. The protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Negative Regulation of intrinsic apoptotic Signaling