SYVN1 antibody (C-Term)
-
- Target See all SYVN1 Antibodies
- SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SYVN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SYVN1 antibody was raised against the C terminal of SYVN1
- Purification
- Affinity purified
- Immunogen
- SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV
- Top Product
- Discover our top product SYVN1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SYVN1 Blocking Peptide, catalog no. 33R-1484, is also available for use as a blocking control in assays to test for specificity of this SYVN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYVN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SYVN1 (Synovial Apoptosis Inhibitor 1, Synoviolin (SYVN1))
- Alternative Name
- SYVN1 (SYVN1 Products)
- Background
- SYVN1 is a protein involved in endoplasmic reticulum (ER)-associated degradation. The protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling, Negative Regulation of intrinsic apoptotic Signaling
-