UGT1A4 antibody (N-Term)

Catalog No. ABIN635830

Product Details anti-UGT1A4 Antibody

Target: UGT1A4 (UDP Glucuronosyltransferase 1 Family, Polypeptide A4 (UGT1A4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGT1A4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGT1 A4 antibody was raised against the N terminal of µgT1 4

Purification: Affinity purified

Immunogen: UGT1 A4 antibody was raised using the N terminal of µgT1 4 corresponding to a region with amino acids VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGT1A4 Blocking Peptide, catalog no. 33R-9886, is also available for use as a blocking control in assays to test for specificity of this µgT1A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGT1A4

Target: UGT1A4 (UDP Glucuronosyltransferase 1 Family, Polypeptide A4 (UGT1A4))

Alternative Name: UGT1A4 (UGT1A4 Products)

Synonyms: HUG-BR2 antibody, UDPGT antibody, UDPGT 1-4 antibody, UGT-1D antibody, UGT1-04 antibody, UGT1.4 antibody, UGT1D antibody, UGT1 antibody, UGT1A4 antibody, UDP glucuronosyltransferase family 1 member A4 antibody, UDP-glucuronosyltransferase 1-4 antibody, UGT1A4 antibody, UGT1-4 antibody

Background: UGT1A4 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha