BRI3BP antibody (C-Term)

Catalog No. ABIN635825

Product Details anti-BRI3BP Antibody

Target: BRI3BP (BRI3 Binding Protein (BRI3BP))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BRI3BP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BRI3 BP antibody was raised against the C terminal of BRI3 P

Purification: Affinity purified

Immunogen: BRI3 BP antibody was raised using the C terminal of BRI3 P corresponding to a region with amino acids GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BRI3BP Blocking Peptide, catalog no. 33R-3270, is also available for use as a blocking control in assays to test for specificity of this BRI3BP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRI0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BRI3BP

Target: BRI3BP (BRI3 Binding Protein (BRI3BP))

Alternative Name: BRI3BP (BRI3BP Products)

Synonyms: fa20c12 antibody, wu:fa20c12 antibody, kg19 antibody, bnas1 antibody, hccr-2 antibody, BNAS1 antibody, HCCR-1 antibody, HCCR-2 antibody, HCCRBP-1 antibody, KG19 antibody, 2410150I18Rik antibody, AI841257 antibody, AW742481 antibody, bri3 binding protein antibody, BRI3 binding protein pseudogene antibody, BRI3 binding protein L homeolog antibody, BRI3 binding protein antibody, Bri3 binding protein antibody, bri3bp antibody, LOC452360 antibody, bri3bp.L antibody, BRI3BP antibody, Bri3bp antibody

Background: BRI3BP is involved in the structural dynamics of the ER and affects mitochondrial viability.It is widely expressed in animal cell types, that seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.

Molecular Weight: 28 kDa (MW of target protein)