TIM3 antibody (N-Term)

Catalog No. ABIN635817

Product Details anti-TIM3 Antibody

Target: TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))

Binding Specificity: N-Term

Reactivity: Hepatitis A Virus (HAV)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TIM3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HAVCR2 antibody was raised against the N terminal of HAVCR2

Purification: Affinity purified

Immunogen: HAVCR2 antibody was raised using the N terminal of HAVCR2 corresponding to a region with amino acids MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAVCR2 Blocking Peptide, catalog no. 33R-6002, is also available for use as a blocking control in assays to test for specificity of this HAVCR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAVCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TIM3

Target: TIM3 (TIM 3) (Hepatitis A Virus Cellular Receptor 2 (TIM 3))

Alternative Name: HAVCR2 (TIM 3 Products)

Synonyms: HAVCR2 antibody, MGC140131 antibody, HAVcr-2 antibody, KIM-3 antibody, TIM3 antibody, TIMD-3 antibody, TIMD3 antibody, Tim-3 antibody, TIM-3 antibody, Tim3 antibody, Timd3 antibody, tim3 antibody, hepatitis A virus cellular receptor 2 antibody, HAVCR2 antibody, Havcr2 antibody

Target Type: Virus

Background: HAVCR2 regulates macrophage activation. HAVCR2 inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. HAVCR2 may be also involved in T-cell homing.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha, Cancer Immune Checkpoints