B3GALTL antibody (Middle Region)
-
- Target See all B3GALTL Antibodies
- B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This B3GALTL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- B3 GALTL antibody was raised against the middle region of B3 ALTL
- Purification
- Affinity purified
- Immunogen
- B3 GALTL antibody was raised using the middle region of B3 ALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE
- Top Product
- Discover our top product B3GALTL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
B3GALTL Blocking Peptide, catalog no. 33R-2243, is also available for use as a blocking control in assays to test for specificity of this B3GALTL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALTL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALTL (beta 1,3-Galactosyltransferase-Like (B3GALTL))
- Alternative Name
- B3GALTL (B3GALTL Products)
- Synonyms
- B3GLCT antibody, B3GTL antibody, B3Glc-T antibody, Gal-T antibody, beta3Glc-T antibody, Gm1057 antibody, beta 3-glucosyltransferase antibody, beta 3-glucosyltransferase L homeolog antibody, beta-3-glucosyltransferase antibody, B3GLCT antibody, b3glct antibody, b3glct.L antibody, B3glct antibody
- Background
- B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin type-1 repeats (TSRs) of many biologically important proteins.
- Molecular Weight
- 56 kDa (MW of target protein)
-