GALNT5 antibody

Catalog No. ABIN635812

Product Details anti-GALNT5 Antibody

Target: GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALNT5 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GALNT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALNT5 Blocking Peptide, catalog no. 33R-2573, is also available for use as a blocking control in assays to test for specificity of this GALNT5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALNT5

Target: GALNT5 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 5 (GalNAc-T5) (GALNT5))

Alternative Name: GALNT5 (GALNT5 Products)

Synonyms: GALNAC-T5 antibody, GALNACT5 antibody, GALNT5 antibody, 4832424J23 antibody, polypeptide N-acetylgalactosaminyltransferase 5 antibody, GALNT5 antibody, Galnt5 antibody

Background: GALNT5 can catalyze the initial reaction in O-linked oligosaccharide biosynthesis,the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. GALNT5 has activity toward EA2 peptide substrate, but it has a weak activity toward Muc2 or Muc1b substrates.

Molecular Weight: 106 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process