BTN2A1 antibody (N-Term)
-
- Target See all BTN2A1 Antibodies
- BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BTN2A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BTN2 A1 antibody was raised against the N terminal of BTN2 1
- Purification
- Affinity purified
- Immunogen
- BTN2 A1 antibody was raised using the N terminal of BTN2 1 corresponding to a region with amino acids SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH
- Top Product
- Discover our top product BTN2A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BTN2A1 Blocking Peptide, catalog no. 33R-8900, is also available for use as a blocking control in assays to test for specificity of this BTN2A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTN0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BTN2A1 (butyrophilin, Subfamily 2, Member A1 (BTN2A1))
- Alternative Name
- BTN2A1 (BTN2A1 Products)
- Background
- This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin geneuperfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Activated T Cell Proliferation
-