CEACAM4 antibody (N-Term)

Catalog No. ABIN635809

Product Details anti-CEACAM4 Antibody

Target: CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CEACAM4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CEACAM4 antibody was raised against the N terminal of CEACAM4

Purification: Affinity purified

Immunogen: CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CEACAM4 Blocking Peptide, catalog no. 33R-3092, is also available for use as a blocking control in assays to test for specificity of this CEACAM4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CEACAM4

Target: CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))

Alternative Name: CEACAM4 (CEACAM4 Products)

Synonyms: CGM7 antibody, CGM7_HUMAN antibody, NCA antibody, carcinoembryonic antigen related cell adhesion molecule 4 antibody, carcinoembryonic antigen-related cell adhesion molecule 4 antibody, CEACAM4 antibody, LOC456061 antibody, Ceacam4 antibody

Background: CEACAM4 belongs to the immunoglobulin superfamily.

Molecular Weight: 26 kDa (MW of target protein)