CEACAM4 antibody (N-Term)
-
- Target See all CEACAM4 Antibodies
- CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CEACAM4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CEACAM4 antibody was raised against the N terminal of CEACAM4
- Purification
- Affinity purified
- Immunogen
- CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD
- Top Product
- Discover our top product CEACAM4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CEACAM4 Blocking Peptide, catalog no. 33R-3092, is also available for use as a blocking control in assays to test for specificity of this CEACAM4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CEACAM4 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 4 (CEACAM4))
- Alternative Name
- CEACAM4 (CEACAM4 Products)
- Background
- CEACAM4 belongs to the immunoglobulin superfamily.
- Molecular Weight
- 26 kDa (MW of target protein)
-