Glycoprotein antibody

Catalog No. ABIN635807

Product Details

Target: Glycoprotein

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Glycoprotein Blocking Peptide, catalog no. 33R-1913, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPNMB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Glycoprotein

Synonyms: glycoprotein antibody, Glycoprotein antibody, transmembrane glycoprotein G antibody, G antibody, RVFV_sM_gp1 antibody, RABVgp4 antibody

Target Type: Viral Protein

Background: GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.

Molecular Weight: 60 kDa (MW of target protein)