ISLR2 antibody (N-Term)

Catalog No. ABIN635806

Product Details anti-ISLR2 Antibody

Target: ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))

Binding Specificity: N-Term

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ISLR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ISLR2 antibody was raised against the N terminal of ISLR2

Purification: Affinity purified

Immunogen: ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ISLR2 Blocking Peptide, catalog no. 33R-7074, is also available for use as a blocking control in assays to test for specificity of this ISLR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISLR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ISLR2

Target: ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))

Alternative Name: ISLR2 (ISLR2 Products)

Synonyms: LINX antibody, B930052A04Rik antibody, Linx antibody, Mbu-3 antibody, mKIAA1465 antibody, immunoglobulin superfamily containing leucine rich repeat 2 antibody, immunoglobulin superfamily containing leucine-rich repeat 2 antibody, ISLR2 antibody, Islr2 antibody

Background: ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.

Molecular Weight: 79 kDa (MW of target protein)

Pathways: Regulation of Cell Size