ISLR2 antibody (N-Term)
-
- Target See all ISLR2 Antibodies
- ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ISLR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ISLR2 antibody was raised against the N terminal of ISLR2
- Purification
- Affinity purified
- Immunogen
- ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA
- Top Product
- Discover our top product ISLR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ISLR2 Blocking Peptide, catalog no. 33R-7074, is also available for use as a blocking control in assays to test for specificity of this ISLR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISLR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ISLR2 (Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2 (ISLR2))
- Alternative Name
- ISLR2 (ISLR2 Products)
- Synonyms
- LINX antibody, B930052A04Rik antibody, Linx antibody, Mbu-3 antibody, mKIAA1465 antibody, immunoglobulin superfamily containing leucine rich repeat 2 antibody, immunoglobulin superfamily containing leucine-rich repeat 2 antibody, ISLR2 antibody, Islr2 antibody
- Background
- ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.
- Molecular Weight
- 79 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-