SLAMF6 antibody (N-Term)

Catalog No. ABIN635797

Product Details anti-SLAMF6 Antibody

Target: SLAMF6 (SLAM Family Member 6 (SLAMF6))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLAMF6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLAMF6 antibody was raised against the N terminal of SLAMF6

Purification: Affinity purified

Immunogen: SLAMF6 antibody was raised using the N terminal of SLAMF6 corresponding to a region with amino acids NFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLAMF6 Blocking Peptide, catalog no. 33R-6685, is also available for use as a blocking control in assays to test for specificity of this SLAMF6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLAMF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLAMF6

Target: SLAMF6 (SLAM Family Member 6 (SLAMF6))

Alternative Name: SLAMF6 (SLAMF6 Products)

Synonyms: SLAMF6 antibody, CD352 antibody, KALI antibody, KALIb antibody, Ly108 antibody, NTB-A antibody, NTBA antibody, SF2000 antibody, KAL1 antibody, KAL1b antibody, RGD1561848 antibody, SLAM family member 6 antibody, SLAMF6 antibody, Slamf6 antibody

Background: SLAMF6 is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. SLAMF6 is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). It may function as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.

Molecular Weight: 34 kDa (MW of target protein)