TMEM48 antibody (Middle Region)
-
- Target See all TMEM48 Antibodies
- TMEM48 (Transmembrane Protein 48 (TMEM48))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM48 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TMEM48 antibody was raised against the middle region of TMEM48
- Purification
- Affinity purified
- Immunogen
- TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD
- Top Product
- Discover our top product TMEM48 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TMEM48 Blocking Peptide, catalog no. 33R-8441, is also available for use as a blocking control in assays to test for specificity of this TMEM48 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM48 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM48 (Transmembrane Protein 48 (TMEM48))
- Alternative Name
- TMEM48 (TMEM48 Products)
- Synonyms
- 2810475A17Rik antibody, AI450313 antibody, Tmem48 antibody, NET3 antibody, TMEM48 antibody, tmem48 antibody, wu:fk93f04 antibody, zgc:55636 antibody, Xndr antibody, NDC1 transmembrane nucleoporin antibody, NDC1 transmembrane nucleoporin S homeolog antibody, Xrcc1 N-terminal domain containing 1 antibody, Ndc1 antibody, NDC1 antibody, ndc1 antibody, ndc1.S antibody, Xndc1 antibody
- Background
- TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.
- Molecular Weight
- 76 kDa (MW of target protein)
-