TMEM48 antibody (Middle Region)

Catalog No. ABIN635787

Product Details anti-TMEM48 Antibody

Target: TMEM48 (Transmembrane Protein 48 (TMEM48))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM48 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM48 antibody was raised against the middle region of TMEM48

Purification: Affinity purified

Immunogen: TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM48 Blocking Peptide, catalog no. 33R-8441, is also available for use as a blocking control in assays to test for specificity of this TMEM48 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM48 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM48

Target: TMEM48 (Transmembrane Protein 48 (TMEM48))

Alternative Name: TMEM48 (TMEM48 Products)

Synonyms: 2810475A17Rik antibody, AI450313 antibody, Tmem48 antibody, NET3 antibody, TMEM48 antibody, tmem48 antibody, wu:fk93f04 antibody, zgc:55636 antibody, Xndr antibody, NDC1 transmembrane nucleoporin antibody, NDC1 transmembrane nucleoporin S homeolog antibody, Xrcc1 N-terminal domain containing 1 antibody, Ndc1 antibody, NDC1 antibody, ndc1 antibody, ndc1.S antibody, Xndc1 antibody

Background: TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.

Molecular Weight: 76 kDa (MW of target protein)