IGSF9 antibody (N-Term)

Catalog No. ABIN635786

Product Details anti-IGSF9 Antibody

Target: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGSF9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IGSF9 antibody was raised against the N terminal of IGSF9

Purification: Affinity purified

Immunogen: IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGSF9 Blocking Peptide, catalog no. 33R-8693, is also available for use as a blocking control in assays to test for specificity of this IGSF9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGSF9

Target: IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))

Alternative Name: IGSF9 (IGSF9 Products)

Synonyms: FP18798 antibody, IGSF9A antibody, Nrt1 antibody, 644ETD8 antibody, Dasm1 antibody, Kiaa1355-hp antibody, NRT1 antibody, Ncaml antibody, mKIAA1355 antibody, immunoglobulin superfamily member 9 antibody, immunoglobulin superfamily, member 9 antibody, IGSF9 antibody, igsf9 antibody, Igsf9 antibody

Background: IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.

Molecular Weight: 125 kDa (MW of target protein)