IGSF9 antibody (N-Term)
-
- Target See all IGSF9 Antibodies
- IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IGSF9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IGSF9 antibody was raised against the N terminal of IGSF9
- Purification
- Affinity purified
- Immunogen
- IGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA
- Top Product
- Discover our top product IGSF9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IGSF9 Blocking Peptide, catalog no. 33R-8693, is also available for use as a blocking control in assays to test for specificity of this IGSF9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGSF9 (Immunoglobulin Superfamily, Member 9 (IGSF9))
- Alternative Name
- IGSF9 (IGSF9 Products)
- Synonyms
- FP18798 antibody, IGSF9A antibody, Nrt1 antibody, 644ETD8 antibody, Dasm1 antibody, Kiaa1355-hp antibody, NRT1 antibody, Ncaml antibody, mKIAA1355 antibody, immunoglobulin superfamily member 9 antibody, immunoglobulin superfamily, member 9 antibody, IGSF9 antibody, igsf9 antibody, Igsf9 antibody
- Background
- IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.
- Molecular Weight
- 125 kDa (MW of target protein)
-