ADAM7 antibody (C-Term)

Catalog No. ABIN635785

Product Details anti-ADAM7 Antibody

Target: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAM7 antibody was raised against the C terminal of ADAM7

Purification: Affinity purified

Immunogen: ADAM7 antibody was raised using the C terminal of ADAM7 corresponding to a region with amino acids PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM7 Blocking Peptide, catalog no. 33R-7385, is also available for use as a blocking control in assays to test for specificity of this ADAM7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM7

Target: ADAM7 (ADAM Metallopeptidase Domain 7 (ADAM7))

Alternative Name: ADAM7 (ADAM7 Products)

Synonyms: ADAM7 antibody, 9230104J12Rik antibody, EAP1 antibody, EAPI antibody, ADAM 7 antibody, ADAM-7 antibody, GP-83 antibody, GP83 antibody, 7 antibody, ADAM antibody, EAP antibody, EAP I antibody, I antibody, ADAM metallopeptidase domain 7 antibody, a disintegrin and metallopeptidase domain 7 antibody, ADAM7 antibody, Adam7 antibody

Background: The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.

Molecular Weight: 83 kDa (MW of target protein)

Pathways: Notch Signaling