SI antibody

Catalog No. ABIN635778

Product Details anti-SI Antibody

Target: SI

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SI antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SI antibody was raised using a synthetic peptide corresponding to a region with amino acids NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SI Blocking Peptide, catalog no. 33R-6891, is also available for use as a blocking control in assays to test for specificity of this SI antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SI

Target: SI

Abstract: SI Products

Synonyms: 2010204N08Rik antibody, SI antibody, Si-s antibody, SUCIMAL antibody, sucrase-isomaltase antibody, sucrase isomaltase (alpha-glucosidase) antibody, SI antibody, Sis antibody, Si antibody

Background: SI belongs to the glycosyl hydrolase 31 family. It plays an important role in the final stage of carbohydrate digestion.

Molecular Weight: 209 kDa (MW of target protein)