FCRLA antibody (C-Term)

Catalog No. ABIN635774

Product Details anti-FCRLA Antibody

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FCRLA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FCRLA antibody was raised against the C terminal of FCRLA

Purification: Affinity purified

Immunogen: FCRLA antibody was raised using the C terminal of FCRLA corresponding to a region with amino acids MPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRKPGTTKATAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FCRLA Blocking Peptide, catalog no. 33R-6273, is also available for use as a blocking control in assays to test for specificity of this FCRLA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCRLA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FCRLA

Target: FCRLA (Fc Receptor-Like A (FCRLA))

Alternative Name: FCRLA (FCRLA Products)

Background: Receptors for the Fc fragment of IgG, or FCGRs, are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLA may be implicated in B-cell differentiation and lymphomagenesis.

Molecular Weight: 41 kDa (MW of target protein)