BTNL3 antibody (N-Term)

Catalog No. ABIN635769

Product Details anti-BTNL3 Antibody

Target: BTNL3 (Butyrophilin-Like 3 (BTNL3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BTNL3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BTNL3 antibody was raised against the N terminal of BTNL3

Purification: Affinity purified

Immunogen: BTNL3 antibody was raised using the N terminal of BTNL3 corresponding to a region with amino acids EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BTNL3 Blocking Peptide, catalog no. 33R-2333, is also available for use as a blocking control in assays to test for specificity of this BTNL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BTNL3

Target: BTNL3 (Butyrophilin-Like 3 (BTNL3))

Alternative Name: BTNL3 (BTNL3 Products)

Synonyms: BTNLR antibody, Btnl1 antibody, butyrophilin like 3 antibody, butyrophilin-like 3 antibody, butyrophilin-like protein 3 antibody, BTNL3 antibody, Btnl3 antibody, LOC100586129 antibody

Background: The specific function of BTNL3 is not yet known.

Molecular Weight: 52 kDa (MW of target protein)